missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HECTD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HECTD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HECTD2 Polyclonal specifically detects HECTD2 in Human samples. It is validated for Western Blot.Specifications
| HECTD2 | |
| Polyclonal | |
| Rabbit | |
| EC 6.3.2.-, FLJ16050, FLJ37306, HECT domain containing 2, HECT domain-containing protein 2, probable E3 ubiquitin-protein ligase HECTD2 | |
| HECTD2 | |
| IgG | |
| 88 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 143279 | |
| Synthetic peptides corresponding to HECTD2(HECT domain containing 2) The peptide sequence was selected from the C terminal of HECTD2. Peptide sequence TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title