missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HEATR4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HEATR4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HEATR4 Polyclonal specifically detects HEATR4 in Human samples. It is validated for Western Blot.Specifications
| HEATR4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| HEAT repeat containing 4, HEAT repeat-containing protein 4, MGC48595 | |
| HEATR4 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_976054 | |
| 399671 | |
| Synthetic peptide directed towards the N terminal of human HEATR4The immunogen for this antibody is HEATR4. Peptide sequence VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title