missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HDJ2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HDJ2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HDJ2 Polyclonal specifically detects HDJ2 in Mouse samples. It is validated for Western Blot.Specifications
| HDJ2 | |
| Polyclonal | |
| Rabbit | |
| NP_032324 | |
| 3301 | |
| Synthetic peptide directed towards the N terminal of human Dnaja1. Peptide sequence YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dj-2, DjA1, DnaJ (Hsp40) homolog, subfamily A, member 1, dnaJ homolog subfamily A member 1, DnaJ protein homolog 2, DNAJ2, hDJ-2, HDJ2, Heat shock 40 kDa protein 4, Heat shock protein J2, heat shock protein, DNAJ-like 2, HSDJ, HSJ2, HSJ-2, HSPF4hdj-2, Human DnaJ protein 2, NEDD7, neural precursor cell expressed, developmentally down-regulated 7 | |
| DNAJA1 | |
| IgG | |
| 44 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title