missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
HDHD1A Polyclonal specifically detects HDHD1A in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | HDHD1A |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | DXF68S1E5'-PsiMPase, EC 3.1.3.n6, family with sequence similarity 16, member A, X-linked, GS1FAM16AX, haloacid dehalogenase-like hydrolase domain containing 1, haloacid dehalogenase-like hydrolase domain containing 1A, Haloacid dehalogenase-like hydrolase domain-containing protein 1, Haloacid dehalogenase-like hydrolase domain-containing protein 1A, HDHD1Apseudouridine-5'-monophosphatase, Protein GS1 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HDHD1 (NP_001129037.1). Peptide sequence THLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAA |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?