missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HDHD1A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | HDHD1A |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
HDHD1A Polyclonal specifically detects HDHD1A in Human samples. It is validated for Western Blot.Specifications
| HDHD1A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| DXF68S1E5'-PsiMPase, EC 3.1.3.n6, family with sequence similarity 16, member A, X-linked, GS1FAM16AX, haloacid dehalogenase-like hydrolase domain containing 1, haloacid dehalogenase-like hydrolase domain containing 1A, Haloacid dehalogenase-like hydrolase domain-containing protein 1, Haloacid dehalogenase-like hydrolase domain-containing protein 1A, HDHD1Apseudouridine-5'-monophosphatase, Protein GS1 | |
| The immunogen is a synthetic peptide directed towards the middle region of human HDHD1 (NP_001129037.1). Peptide sequence SVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVE | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 8226 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title