missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HDDC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HDDC3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HDDC3 Polyclonal specifically detects HDDC3 in Human samples. It is validated for Western Blot.Specifications
| HDDC3 | |
| Polyclonal | |
| Rabbit | |
| (ppGpp)ase, EC 3.1.7.2, guanosine-3'-5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1, HD domain containing 3, HD domain-containing protein 3, MESH1, Metazoan SpoT homolog 1, metazoan SpoT homolog-1, MGC45386, Penta-phosphate guanosine-3'-pyrophosphohydrolase | |
| HDDC3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 374659 | |
| Synthetic peptides corresponding to HDDC3(HD domain containing 3) The peptide sequence was selected from the middle region of HDDC3. Peptide sequence TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title