missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HDC2/PHC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HDC2/PHC2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HDC2/PHC2 Polyclonal specifically detects HDC2/PHC2 in Human samples. It is validated for Western Blot.Specifications
| HDC2/PHC2 | |
| Polyclonal | |
| Rabbit | |
| NP_932157 | |
| 1912 | |
| Synthetic peptide directed towards the N terminal of human PHC2. Peptide sequence GGSGRPTGPQISVYSGIPDRQTVQVIQQALHRQPSTAAQYLQQMYAAQQQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| early development regulator 2 (homolog of polyhomeotic 2), Early development regulatory protein 2, EDR2, hPH2, MGC163502, PH2, polyhomeotic 2, polyhomeotic homolog 2 (Drosophila), polyhomeotic-like 2, polyhomeotic-like 2 (Drosophila), polyhomeotic-like protein 2 | |
| PHC2 | |
| IgG | |
| 91 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title