HDAC10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56663

Product Code. 18219783

Description

HDAC10 Polyclonal specifically detects HDAC10 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: HDAC10
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DKFZP761B039, EC 3.5.1.98, HD10, histone deacetylase 10, MGC149722
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: HDAC10
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLAAMLRGLAGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKMLQC
• Quantity: 100 μL
• Research Discipline: Breast Cancer, Cancer, Checkpoint signaling, Chromatin Research, Epigenetics, Histone Deacetylases, Transcription Factors and Regulators
• Gene ID (Entrez): 83933
• Target Species: Human
• Isotype: IgG

For Research Use Only