missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HCC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £442.00
Specifications
| Antigen | HCC1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228455
|
Novus Biologicals
NBP3-35596-20ul |
20 μL |
£164.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232344
|
Novus Biologicals
NBP3-35596-100ul |
100 μL |
£442.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HCC1 Polyclonal antibody specifically detects HCC1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpecifications
| HCC1 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cellular Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 9584 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| CAPER, CC1.3, coactivator of activating protein-1 and estrogen receptors, DKFZp781C0423, FLJ44170, fSAP59, functional spliceosome-associated protein 59, HCC1CAPERalpha, Hepatocellular carcinoma protein 1, RNA binding motif protein 39, RNA-binding motif protein 39, RNA-binding protein 39, RNA-binding region-containing protein 2, RNPC2, RRM) containing 2, splicing factor CC1.3, Splicing factor HCC1 | |
| A synthetic peptide corresponding to a sequence within amino acids 400-508 of human HCC1 (NP_001229528.1).,, Sequence:, ATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title