missing translation for 'onlineSavingsMsg'
Learn More

HCC1 Antibody (4G8), Novus Biologicals™

Product Code. 18398048 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18398048 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18398048 Supplier Novus Biologicals Supplier No. H00009584M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

HCC1 Monoclonal antibody specifically detects HCC1 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen HCC1
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 4G8
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_909122
Gene Alias CAPER, CC1.3, coactivator of activating protein-1 and estrogen receptors, DKFZp781C0423, FLJ44170, fSAP59, functional spliceosome-associated protein 59, HCC1CAPERalpha, Hepatocellular carcinoma protein 1, RNA binding motif protein 39, RNA-binding motif protein 39, RNA-binding protein 39, RNA-binding region-containing protein 2, RNPC2, RRM) containing 2, splicing factor CC1.3, Splicing factor HCC1
Host Species Mouse
Immunogen RNPC2 (NP_909122, 423 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cellular Markers
Primary or Secondary Primary
Gene ID (Entrez) 9584
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.