missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HBS1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-52835
This item is not returnable.
View return policy
Description
HBS1L Polyclonal specifically detects HBS1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence.
Specifications
| HBS1L | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp434g247, ERF3-similar protein, ERFSDKFZp686L13262, HBS1 (S. cerevisiae)-like, HBS1KIAA1038EF-1a, HBS1-like (S. cerevisiae), HBS1-like protein, Hsp70 subfamily B suppressor 1-like protein, HSPC276 | |
| Rabbit | |
| 22 kDa | |
| 100 μL | |
| Signal Transduction | |
| 10767 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin | |
| Q9Y450 | |
| HBS1L | |
| Synthetic peptides corresponding to HBS1L(HBS1-like (S. cerevisiae)) The peptide sequence was selected from the C terminal of HBS1L. Peptide sequence MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction