missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HAO2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17862-100UL
This item is not returnable.
View return policy
Description
HAO2 Polyclonal antibody specifically detects HAO2 in Human samples. It is validated for Western Blot
Specifications
| HAO2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/ml | |
| (S)-2-hydroxy-acid oxidase, peroxisomal, Cell growth-inhibiting gene 16 protein, EC 1.1.3.15, GIG16, growth-inhibiting protein 16, HAOX2glycolate oxidase, hydroxyacid oxidase 2, hydroxyacid oxidase 2 (long chain), Long chain alpha-hydroxy acid oxidase, Long-chain L-2-hydroxy acid oxidase | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSWFQSITRLPIILKGILTKEDAELAVKHNVQG | |
| 100 μg | |
| Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
| 51179 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction