missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HAND2 Antibody (4E12), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00009464-M04
This item is not returnable.
View return policy
Description
HAND2 Monoclonal antibody specifically detects HAND2 in Human samples. It is validated for Western Blot, ELISA
Specifications
| HAND2 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2 | |
| HAND2 (NP_068808.1, 135 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK | |
| 0.1 mg | |
| Angiogenesis | |
| 9464 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA | |
| 4E12 | |
| Western Blot 1:500 | |
| NP_068808 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction