missing translation for 'onlineSavingsMsg'
Learn More

HAND2 Antibody (3D5), Novus Biologicals™

Product Code. 18328158 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18328158 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18328158 Supplier Novus Biologicals Supplier No. H00009464M06

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

HAND2 Monoclonal antibody specifically detects HAND2 in Human samples. It is validated for Western Blot, ELISA, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen HAND2
Applications Western Blot, ELISA, KnockDown
Classification Monoclonal
Clone 3D5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_068808
Gene Alias BHLHA26, bHLHa26MGC125303, dHAND, DHAND2, FLJ16260, heart and neural crest derivatives expressed 2, heart, autonomic nervous system and neural crestderivatives-expressed protein 2, Hed, MGC125304, Thing2
Host Species Mouse
Immunogen HAND2 (NP_068808.1, 135 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Angiogenesis
Primary or Secondary Primary
Gene ID (Entrez) 9464
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.