missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HADHB Antibody, Novus Biologicals™

HADHB Antibody, Novus Biologicals™

Product Code. 18405031 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18405031 25 μL 25µL
18748023 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18405031 Supplier Novus Biologicals Supplier No. NBP18260925ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

HADHB Polyclonal specifically detects HADHB in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockout Validated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen HADHB
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 2-enoyl-Coenzyme A (CoA) hydratase, beta subunit, 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, acetyl-CoA acyltransferase, beta subunit, beta-ketothiolase, EC 2.3.1, EC 2.3.1.16, ECHB, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit, hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, MGC87480, mitochondrial trifunctional enzyme, beta subunit, mitochondrial trifunctional protein, beta subunit, MTPB, TP-beta, trifunctional enzyme subunit beta, mitochondrial
Gene Symbols HADHB
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 3032
Test Specificity Specificity of human HADHB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.