missing translation for 'onlineSavingsMsg'
Learn More

H4/h Antibody (6D4), Novus Biologicals™

Product Code. 18389018 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18389018 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18389018 Supplier Novus Biologicals Supplier No. H00008365M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

H4/h Monoclonal antibody specifically detects H4/h in Human samples. It is validated for ELISA, Immunocytochemistry/ Immunofluorescence, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen H4/h
Applications ELISA, Immunocytochemistry, Sandwich ELISA
Classification Monoclonal
Clone 6D4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003534
Gene Alias H4 histone family, member H, H4/A, H4/B, H4/C, H4/D, H4/E, H4/h, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FHH4/G, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4I, HIST1H4J, HIST1H4K, HIST1H4L, HIST2H4, HIST2H4A, HIST2H4B, HIST4H4, histone 1, H4h, histone cluster 1, H4h, histone H4
Host Species Mouse
Immunogen HIST1H4H (NP_003534, 31 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8365
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.