missing translation for 'onlineSavingsMsg'
Learn More
Learn More
H4 Clustered Histone 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35167-20ul
This item is not returnable.
View return policy
Description
H4 Clustered Histone 1 Polyclonal antibody specifically detects H4 Clustered Histone 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| H4 Clustered Histone 1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| H4-16;H4C11;H4C12;H4C13;H4C14;H4C15;H4C2;H4C3;H4C4;H4C5;H4C6;H4C8;H4C9;H4FA, H4F4, HIST1H4A | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human H4 Clustered Histone 1 (NP_003529.1).,, Sequence:, MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 8359 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction