missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Guanylyl Cyclase beta 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-85021-0.1ML
This item is not returnable.
View return policy
Description
Guanylyl Cyclase beta 1 Polyclonal specifically detects Guanylyl Cyclase beta 1 in Human samples. It is validated for Western Blot.
Specifications
| Guanylyl Cyclase beta 1 | |
| Polyclonal | |
| PBS, 2% Sucrose | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit | |
| The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS | |
| 0.1 mL | |
| Signal Transduction | |
| 2983 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction