missing translation for 'onlineSavingsMsg'
Learn More

Guanylate kinase Antibody, Novus Biologicals™

Product Code. 18352291 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18352291 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18352291 Supplier Novus Biologicals Supplier No. NBP276521

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Guanylate kinase Polyclonal specifically detects Guanylate kinase in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Guanylate kinase
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μ/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias EC 2.7.4.8, FLJ42686, FLJ43710, GMK, GMP kinase, guanylate kinase, guanylate kinase 1
Gene Symbols GUK1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GSQETFHLGAPVETTCLAGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNP
Quantity 100 μL
Primary or Secondary Primary
Gene ID (Entrez) 2987
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.