GTSF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP1-83934-25ul

Código de producto. 18430371

Descripción

GTSF1 Polyclonal specifically detects GTSF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Especificaciones

• Antigen: GTSF1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: FAM112B, family with sequence similarity 112, member B, FLJ32942, gametocyte specific factor 1, gametocyte-specific factor 1, Protein FAM112B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GTSF1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQ
• Quantity: 25 μL
• Research Discipline: Developmental Biology
• Gene ID (Entrez): 121355
• Target Species: Human
• Isotype: IgG

For Research Use Only