missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GTSE1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | GTSE1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GTSE1 Polyclonal specifically detects GTSE1 in Human samples. It is validated for Western Blot.Specifications
| GTSE1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| B99, G2 and S phase-expressed protein 1, G-2 and S-phase expressed 1, GTSE-1, Protein B99 homolog | |
| GTSE1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NYZ3 | |
| 51512 | |
| Synthetic peptides corresponding to GTSE1(G-2 and S-phase expressed 1) The peptide sequence was selected from the N terminal of GTSE1. Peptide sequence NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title