missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18399758

GTP-binding protein 1 Antibody (1H1), Novus Biologicals™

Product Code. 18399758 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18399758 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18399758 Supplier Novus Biologicals Supplier No. H00009567M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

GTP-binding protein 1 Monoclonal antibody specifically detects GTP-binding protein 1 in Human samples. It is validated for Western Blot, ELISA, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen GTP-binding protein 1
Applications Western Blot, ELISA, Immunoprecipitation
Classification Monoclonal
Clone 1H1
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunoprecipitation
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004277
Gene Alias GP1GTP-binding protein 1, GP-1MGC20069, G-protein 1, GTP binding protein 1, HSPC018
Host Species Mouse
Immunogen GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9567
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.