missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GTF2IRD1 Antibody, Novus Biologicals™

GTF2IRD1 Antibody, Novus Biologicals™

Product Code. 18407711 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18407711 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18407711 Supplier Novus Biologicals Supplier No. NBP19197325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 3 publications

GTF2IRD1 Polyclonal specifically detects GTF2IRD1 in Human, Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockout Validated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen GTF2IRD1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, Chromatin Immunoprecipitation (ChIP), Knockout Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias BEN, CREAM1, General transcription factor III, general transcription factor II-I repeat domain-containing protein 1, GTF2I repeat domain containing 1, GTF2I repeat domain-containing protein 1, GTF3GTF2I repeat domain-containing 1, hMusTRD1alpha1, Muscle TFII-I repeat domain-containing protein 1, muscle TFII-I repeat domain-containing protein 1 alpha 1, MusTRD1, MusTRD1/BEN, MUSTRD1general transcription factor 3, RBAP2WBSCR12binding factor for early enhancer, Slow-muscle-fiber enhancer-binding protein, USE B1-binding protein, WBS, WBSCR11, Williams-Beuren syndrome chromosomal region 11 protein, Williams-Beuren syndrome chromosomal region 12 protein, Williams-Beuren syndrome chromosome region 11
Gene Symbols GTF2IRD1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RPCTYGVPKLKRILEERHSIHFIIKRMFDERIFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSEDSGYGMEMLTD
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9569
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.