missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GTF2H4 Antibody, Novus Biologicals™

GTF2H4 Antibody, Novus Biologicals™

Product Code. 18293395 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18293395 100 μL 100µL
18658356 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18293395 Supplier Novus Biologicals Supplier No. NBP257537

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

GTF2H4 Polyclonal specifically detects GTF2H4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen GTF2H4
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias Basic transcription factor 2 52 kDa subunit, BTF2 p52, General transcription factor IIH polypeptide 4, general transcription factor IIH subunit 4, general transcription factor IIH, polypeptide 4 (52kD subunit), general transcription factor IIH, polypeptide 4, 52kDa, TFB2, TFIIH, TFIIH basal transcription factor complex p52 subunit
Gene Symbols GTF2H4
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA Repair, Nucleotide Excision Repair
Primary or Secondary Primary
Gene ID (Entrez) 2968
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.