missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GTF2A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55408
This item is not returnable.
View return policy
Description
GTF2A2 Polyclonal specifically detects GTF2A2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| GTF2A2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| General transcription factor IIA subunit 2, general transcription factor IIA, 2 (12kD subunit), general transcription factor IIA, 2, 12kDa, HsT18745, TF2A2, TFIIA, TFIIA p12 subunit, TFIIA-12, TFIIA-gamma, TFIIAS, Transcription initiation factor IIA gamma chain, transcription initiation factor IIA subunit 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 2958 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| GTF2A2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction