GSTT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-53049

Product Code. 18232395

Description

GSTT1 Polyclonal specifically detects GSTT1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GSTT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.5.1.18, glutathione S-transferase theta 1, glutathione S-transferase theta-1, Glutathione transferase T1-1, GST class-theta-1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 85%; Bovine: 78%; Guinea pig: 78%; Rabbit: 78%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P30711
• Gene Symbols: GSTT1
• Immunogen: Synthetic peptides corresponding to GSTT1(glutathione S-transferase theta 1) The peptide sequence was selected from the C terminal of GSTT1. Peptide sequence TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR.
• Quantity: 100 μL
• Research Discipline: Asthma, Cancer, Immunology
• Gene ID (Entrez): 2952
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only