missing translation for 'onlineSavingsMsg'
Learn More

GSTA4 Antibody, Novus Biologicals™

Product Code. 18338498 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18338498 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18338498 Supplier Novus Biologicals Supplier No. H00002941B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

GSTA4 Polyclonal antibody specifically detects GSTA4 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen GSTA4
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH15523
Gene Alias DKFZp686D21185, EC 2.5.1.18, glutathione S-alkyltransferase A4, glutathione S-aralkyltransferase A4, glutathione S-aryltransferase A4, glutathione S-transferase A4, Glutathione S-transferase A4-4, glutathione S-transferase alpha 4, glutathione transferase A4-4, GST class-alpha member 4, GSTA4-4, GTA4, S-(hydroxyalkyl)glutathione lyase A4
Host Species Mouse
Immunogen GSTA4 (AAH15523, 1 a.a. - 222 a.a.) full-length human protein. MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 2941
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.