missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18338498

GSTA4 Antibody, Novus Biologicals™

Código de producto. 18338498 Tienda Bio Techne Productos
Change view
Click to view available options
Quantity:
0.05 mg
Tamaño de la unidad:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantity unitSize
18338498 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18338498 Proveedor Novus Biologicals N.º de proveedor H00002941B01P

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Mouse Polyclonal Antibody

GSTA4 Polyclonal antibody specifically detects GSTA4 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen GSTA4
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. AAH15523
Gene Alias DKFZp686D21185, EC 2.5.1.18, glutathione S-alkyltransferase A4, glutathione S-aralkyltransferase A4, glutathione S-aryltransferase A4, glutathione S-transferase A4, Glutathione S-transferase A4-4, glutathione S-transferase alpha 4, glutathione transferase A4-4, GST class-alpha member 4, GSTA4-4, GTA4, S-(hydroxyalkyl)glutathione lyase A4
Host Species Mouse
Immunogen GSTA4 (AAH15523, 1 a.a. - 222 a.a.) full-length human protein. MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 2941
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.