GSPT1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17258-100UL

Product Code. 18311637

Description

GSPT1 Polyclonal antibody specifically detects GSPT1 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: GSPT1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: ERF3A, eRF3aFLJ38048, ETF3A, eukaryotic peptide chain release factor GTP-binding subunit ERF3A, Eukaryotic peptide chain release factor subunit 3a, FLJ39067, G1 to S phase transition 1,551G9.2, G1 to S phase transition protein 1 homolog, GST1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE
• Quantity: 100 μg
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 2935
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified