missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GRSF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57315
This item is not returnable.
View return policy
Description
GRSF1 Polyclonal specifically detects GRSF1 in Human samples. It is validated for Western Blot.
Specifications
| GRSF1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| GRSF1 | |
| Synthetic peptides corresponding to GRSF1 (G-rich RNA sequence binding factor 1) The peptide sequence was selected from the N terminal of GRSF1. Peptide sequence SCRRTGAACLPFYSAASYPALRASLLPQSLAAAAAVPTRSYSQESKTTYL. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Bovine: 84%; Mouse: 84%. | |
| Human, Mouse, Rat, Pig, Bovine | |
| Purified |
| Western Blot | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| FLJ13125, G-rich RNA sequence binding factor 1, G-rich sequence factor 1, GRSF-1 | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 2926 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction