missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GRPEL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | GRPEL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GRPEL1 Polyclonal specifically detects GRPEL1 in Human samples. It is validated for Western Blot.Specifications
| GRPEL1 | |
| Polyclonal | |
| Rabbit | |
| Q9HAV7 | |
| 80273 | |
| Synthetic peptides corresponding to GRPEL1(GrpE-like 1, mitochondrial (E. coli)) The peptide sequence was selected from the N terminal of GRPEL1. Peptide sequence NSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALAD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ25609, GREPEL1, grpE protein homolog 1, mitochondrial, GrpE-like 1, mitochondrial (E. coli), GrpE-like protein cochaperone, HMGEmt-GrpE#1, Mt-GrpE#1 | |
| GRPEL1 | |
| IgG | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title