Invitrogen™ GRK5 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA579331

Product Code. 15924905

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human Hela whole cell, human A549 whole cell, rat heart tissue, mouse heart tissue. IHC: rat cardiac muscle tissue, mouse lung tissue, human placenta tissue.

GRK5 is a serine/threonine kinase that regulates the activity of a variety of G protein-coupled receptors and the motility of polymorphonuclear leukocytes. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes.

Specifications

• Antigen: GRK5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: GRK5
• Gene Alias: 1200003L19Rik; Alpha-CP4; AlphaCP-4; FP2025; G protein-coupled receptor kinase 5; G protein-coupled receptor kinase GRK5; Gprk5; GRK; Grk5; GRK5 protein kinase; GRK-pan; Pan-GRK; Pcbp4; poly(rC) binding protein 4; poly(rC)-binding protein 4
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 11476, 14773, 236300, 2869, 59075, 59092
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P34947, Q62833, Q8VEB1
• Gene Symbols: GRK5
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG