missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GRK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £443.00
Specifications
| Antigen | GRK1 |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18226442
|
Novus Biologicals
NBP2-55226 |
100 μL |
£443.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18618058
|
Novus Biologicals
NBP2-55226-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GRK1 Polyclonal antibody specifically detects GRK1 in Human, Monkey samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen).Specifications
| GRK1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen) | |
| Unconjugated | |
| RUO | |
| Human, Monkey | |
| G protein-coupled receptor kinase 1rhodopsin kinase, GPRK1, RHOKEC 2.7.11, RKEC 2.7.11.14 | |
| GRK1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase, Signal Transduction, Vision | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 6011 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title