GRG (Groucho homolog) Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10933-100UL

Product Code. 18331585

Description

GRG (Groucho homolog) Polyclonal specifically detects GRG (Groucho homolog) in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: GRG (Groucho homolog)
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: AES-1, AES-2, Amino enhancer of split, amino-terminal enhancer of split, ESP1, Gp130-associated protein GAM, GRG, GRG5, Protein ESP1, Protein GRG, TLE5
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse GRG (Groucho homolog) (NP_034477). Peptide sequence QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK
• Quantity: 100 μg
• Research Discipline: Apoptosis, Signal Transduction, Wnt Signaling Pathway
• Gene ID (Entrez): 166
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified