missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
GRB2 Monoclonal antibody specifically detects GRB2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | GRB2 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 9K6H0 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | abundant SRC homology, Adapter protein GRB2, ASH, EGFRBP-GRB2, epidermal growth factor receptor-binding protein GRB2, Grb3-3, growth factor receptor-bound protein 2, growth factor receptor-bound protein 3, HT027, MST084, MSTP084, NCKAP2, Protein Ash, SH2/SH3 adapter GRB2 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 118-217 of human GRB2 (P62993). YFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?