missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GRB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £375.00
Specifications
| Antigen | GRB2 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18214545
|
Novus Biologicals
NBP2-55208 |
100 μL |
£375.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18681387
|
Novus Biologicals
NBP2-55208-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GRB2 Polyclonal specifically detects GRB2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| GRB2 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Breast Cancer, Cancer, Extracellular Matrix, Signal Transduction | |
| abundant SRC homology, Adapter protein GRB2, ASH, EGFRBP-GRB2, epidermal growth factor receptor-binding protein GRB2, Grb3-3, growth factor receptor-bound protein 2, growth factor receptor-bound protein 3, HT027, MST084, MSTP084, NCKAP2, Protein Ash, SH2/SH3 adapter GRB2 | |
| GRB2 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 2885 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title