missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Granulin Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33412-20ul
This item is not returnable.
View return policy
Description
Granulin Monoclonal antibody specifically detects Granulin in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| Granulin | |
| Monoclonal | |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| acrogranin, GEP, GP88, granulin, granulin-epithelin, granulins, PC cell-derived growth factor, PCDGF, PEPI, PGRN, proepithelin, progranulin | |
| A synthetic peptide corresponding to a sequence within amino acids 494-593 of human Granulin (NP_002078.1).,, Sequence:, SCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL | |
| 20 μL | |
| Cancer, Cell Cycle and Replication, Lipid and Metabolism | |
| 2896 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction