GRAF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP2-38235-25ul

Product Code. 18615235

Description

GRAF Polyclonal specifically detects GRAF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GRAF
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q9UNA1
• Gene Symbols: ARHGAP26
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RSSLHAVFSLLVNFVPCHPNLHLLFDRPEEAVHEDSSTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLE
• Quantity: 25 μL
• Research Discipline: Neuroscience, Stem Cell Markers
• Gene ID (Entrez): 23092
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ42530, GRAFGTPase regulator associated with focal adhesion kinase pp125(FAK), KIAA0621rho GTPase-activating protein 26, Oligophrenin-1-like protein, OPHN1L1, OPHN1LGTPase regulator associated with focal adhesion kinase, Rho GTPase activating protein 26, Rho-type GTPase-activating protein 26
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.