missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GPSM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

GPSM1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18376962 Shop All Bio Techne Products
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μg
25 μg
missing translation for 'unitSize'
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18376962 25 μg 25µL
18335552 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
This item is not returnable. View return policy
Product Code. 18376962 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP31785925UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

GPSM1 Polyclonal antibody specifically detects GPSM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen GPSM1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias 1810037C22Rik, C. elegans), DKFZp727I051, G-protein signaling modulator 1, G-protein-signaling modulator 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: RKYQEGPDAERRPREGSHSPLDSADVRVHVPRTSIPRAPSSDEECFFDLLTKFQS
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cell Biology, Cell Cycle and Replication, GPCR, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 26086
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.