missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPR82 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £470.00
Specifications
| Antigen | GPR82 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18447240
|
Novus Biologicals
NBP1-86298 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18448960
|
Novus Biologicals
NBP1-86298-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GPR82 Polyclonal antibody specifically detects GPR82 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| GPR82 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.2) and 40% Glycerol | |
| 27197 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| G protein-coupled receptor 82, probable G-protein coupled receptor 82 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: AISRYATLMQKDSSQETTSCYEKIFYGHLLKKFRQPNFAR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title