missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPR75 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£405.00
Specifications
| Antigen | GPR75 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
GPR75 Polyclonal specifically detects GPR75 in Human samples. It is validated for Western Blot.Specifications
| GPR75 | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| G protein-coupled receptor 75, GPRchr2, MGC132002, probable G-protein coupled receptor 75, WI31133, WI-31133 | |
| GPR75 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B2RC02 | |
| 10936 | |
| Synthetic peptides corresponding to GPR75(G protein-coupled receptor 75) The peptide sequence was selected from the middle region of GPR75. Peptide sequence GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title