missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPR74/NPFFR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifica
| Antigen | GPR74/NPFFR2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Descrizione
GPR74/NPFFR2 Polyclonal specifically detects GPR74/NPFFR2 in Human samples. It is validated for Western Blot.Specifica
| GPR74/NPFFR2 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
| A0PJM9 | |
| 10886 | |
| Synthetic peptides corresponding to NPFFR2 (neuropeptide FF receptor 2) The peptide sequence was selected from the C terminal of NPFFR2. Peptide sequence KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| GPR74G protein-coupled receptor 74, G-protein coupled receptor 74, neuropeptide FF 2, neuropeptide FF receptor 2, Neuropeptide G-protein coupled receptor, NPFF2G-protein coupled receptor HLWAR77, NPGPRHLWAR77 | |
| NPFFR2 | |
| IgG | |
| 46 kDa |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto