GPR74/NPFFR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69056

Product Code. 18254494

Description

GPR74/NPFFR2 Polyclonal specifically detects GPR74/NPFFR2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GPR74/NPFFR2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GPR74G protein-coupled receptor 74, G-protein coupled receptor 74, neuropeptide FF 2, neuropeptide FF receptor 2, Neuropeptide G-protein coupled receptor, NPFF2G-protein coupled receptor HLWAR77, NPGPRHLWAR77
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Research Discipline: GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission
• Gene ID (Entrez): 10886
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: A0PJM9
• Gene Symbols: NPFFR2
• Immunogen: Synthetic peptides corresponding to NPFFR2 (neuropeptide FF receptor 2) The peptide sequence was selected from the C terminal of NPFFR2. Peptide sequence KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.