GPR52 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-33913-25ul

Product Code. 18445182

Description

GPR52 Polyclonal specifically detects GPR52 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GPR52
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9Y2T5
• Gene Symbols: GPR52
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CRQHTKEINDRRARFPSHEVDSSRETGHSPDRRYAM
• Quantity: 25 μL
• Research Discipline: GPCR
• Gene ID (Entrez): 9293
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: G protein-coupled receptor 52, MGC111751, probable G-protein coupled receptor 52
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only