GRK5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56763-25ul

Product Code. 18664297

Description

GRK5 Polyclonal specifically detects GRK5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: GRK5
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 2.7.11, EC 2.7.11.16, FLJ39780, G protein-coupled receptor kinase 5, G protein-coupled receptor kinase GRK5, GPRK5FP2025
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GRK5
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVHEYL
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 2869
• Target Species: Human
• Form: Purified

For Research Use Only