GPR177/WLS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59013

Product Code. 18265273

Description

GPR177/WLS Polyclonal specifically detects GPR177/WLS in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GPR177/WLS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C1orf139, DKFZp686I0788, EVIchromosome 1 open reading frame 139, FLJ23091, G protein-coupled receptor 177, GPR177wls, Integral membrane protein GPR177, MGC131760, MGC14878, MRP, Protein evenness interrupted homolog, protein wntless homolog, Putative NF-kappa-B-activating protein 373, putative NFkB activating protein 373, wntless homolog (Drosophila)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5T9L3
• Gene Symbols: WLS
• Immunogen: Synthetic peptides corresponding to GPR177(G protein-coupled receptor 177) The peptide sequence was selected from the middle region of GPR177. Peptide sequence DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 79971
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only