GPR176 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09730-100UL

Product Code. 18306464

Description

GPR176 Polyclonal specifically detects GPR176 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GPR176
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: G protein-coupled receptor 176, Gm1012, GPR, HB-954, probable G-protein coupled receptor 176, putative G protein coupled receptor
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR176 (NP_009154). Peptide sequence LEPSIRSGSQLLEMFHIGQQQIFKPTEDEEESEAKYIGSADFQAKEIFST
• Quantity: 100 μg
• Research Discipline: GPCR, Signal Transduction, Virology Bacteria and Parasites
• Gene ID (Entrez): 11245
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified