GPR146 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10154-100UL

Artikelnummer. 18074376

Beskrivelse

GPR146 Polyclonal specifically detects GPR146 in Mouse samples. It is validated for Western Blot.

Tekniske data

• Antigen: GPR146
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: G protein-coupled receptor 146, G protein-coupled receptor PGR8, PGR8G-protein coupled receptor PGR8, probable G-protein coupled receptor 146
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of mouse GPR146 (NP_001033792.1). Peptide sequence ERALPRTYMASVYNTRHVCGFVWGGAVLTSFSSLLFYICSHVSSRIAECA
• Quantity: 100 μg
• Research Discipline: GPCR
• Gene ID (Entrez): 115330
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified