GPR137C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58722-25ul

Product Code. 18679057

Description

GPR137C Polyclonal specifically detects GPR137C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: GPR137C
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: G protein-coupled receptor 137C, G protein-coupled receptor TM7SF1L2, integral membrane protein GPR137C, TM7SF1L2DKFZp762F0713, Transmembrane 7 superfamily member 1-like 2 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 283554
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GPR137C
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only