missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
GPR133 Polyclonal antibody specifically detects GPR133 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | GPR133 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | DKFZp434B1272, FLJ16770, G protein-coupled receptor 133, G-protein coupled receptor PGR25, MGC138514, PGR25MGC138512, probable G-protein coupled receptor 133 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WKTQGEQSRPIPSAYGGQVISNGFKVCSSGGRGSVELYTRDNSMTWEASFSPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSRDY |
| Purification Method | Affinity purified |
| Show More |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?