missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPR109B/HM74 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | GPR109B/HM74 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231459
|
Novus Biologicals
NBP3-35830-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227051
|
Novus Biologicals
NBP3-35830-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GPR109B/HM74 Polyclonal antibody specifically detects GPR109B/HM74 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Specifications
| GPR109B/HM74 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, GPCR, Tumor Suppressors | |
| PBS (pH 7.3), 50% glycerol | |
| 8843 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| G protein-coupled receptor 109B, G-protein coupled receptor 109B, G-protein coupled receptor HM74, G-protein coupled receptor HM74B, GTP-binding protein, HCA3, HCAR3, HM74B, HM74Puma-g, Niacin receptor 2, NIACR2, Nicotinic acid receptor 2, PUMAG, putative chemokine receptor | |
| A synthetic peptide corresponding to a sequence within amino acids 300-392 of human GPR109B/HM74 (NP_006009.2).,, Sequence:, SFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title